PDB entry 1fft

View 1fft on RCSB PDB site
Description: The structure of ubiquinol oxidase from Escherichia coli
Class: oxidoreductase
Keywords: electron transport, cytochrome oxidase, membrane protein
Deposited on 2000-07-26, released 2000-10-18
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquinol oxidase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ffta_
  • Chain 'B':
    Compound: ubiquinol oxidase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fftb1, d1fftb2
  • Chain 'C':
    Compound: ubiquinol oxidase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABJ3 (24-End)
      • cloning artifact (18-23)
    Domains in SCOP 1.75: d1fftc_
  • Chain 'D':
    Compound: ubiquinol oxidase
    Species: Escherichia coli
  • Chain 'F':
    Compound: ubiquinol oxidase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fftf_
  • Chain 'G':
    Compound: ubiquinol oxidase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fftg1, d1fftg2
  • Chain 'H':
    Compound: ubiquinol oxidase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABJ3 (24-End)
      • cloning artifact (18-23)
    Domains in SCOP 1.75: d1ffth_
  • Chain 'I':
    Compound: ubiquinol oxidase
    Species: Escherichia coli
  • Heterogens: CU, HEM, HEO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fftA (A:)
    mfgklsldavpfhepivmvtiagiilgglalvglityfgkwtylwkewltsvdhkrlgim
    yiivaivmllrgfadaimmrsqqalasageagflpphhydqiftahgvimiffvampfvi
    glmnlvvplqigardvafpflnnlsfwftvvgvilvnvslgvgefaqtgwlaypplsgie
    yspgvgvdywiwslqlsgigttltginffvtilkmrapgmtmfkmpvftwaslcanvlii
    asfpiltvtvalltldrylgthfftndmggnmmmyinliwawghpevyililpvfgvfse
    iaatfsrkrlfgytslvwatvcitvlsfivwlhhfftmgaganvnaffgittmiiaiptg
    vkifnwlftmyqgrivfhsamlwtigfivtfsvggmtgvllavpgadfvlhnslfliahf
    hnviiggvvfgcfagmtywwpkafgfklnetwgkrafwfwiigffvafmplyalgfmgmt
    rrlsqqidpqfhtmlmiaasgavlialgilclviqmyvsirdrdqnrdltgdpwggrtle
    watsspppfynfavvphvherdafwemkekgeaykkpdhyeeihmpknsgagiviaafst
    ifgfamiwhiwwlaivgfagmiitwivksfdedvdyyvpvaeieklenqhfdeitkaglk
    ngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fftA (A:)
    vdhkrlgimyiivaivmllrgfadaimmrsqqalasageagflpphhydqiftahgvimi
    ffvampfviglmnlvvplqigardvafpflnnlsfwftvvgvilvnvslgvgefaqtgwl
    aypplsgieyspgvgvdywiwslqlsgigttltginffvtilkmrapgmtmfkmpvftwa
    slcanvliiasfpiltvtvalltldrylgthfftndmggnmmmyinliwawghpevyili
    lpvfgvfseiaatfsrkrlfgytslvwatvcitvlsfivwlhhfftmgaganvnaffgit
    tmiiaiptgvkifnwlftmyqgrivfhsamlwtigfivtfsvggmtgvllavpgadfvlh
    nslfliahfhnviiggvvfgcfagmtywwpkafgfklnetwgkrafwfwiigffvafmpl
    yalgfmgmtrrlsqqidpqfhtmlmiaasgavlialgilclviqmyvsirdrdqnrdltg
    dpwggrtlewatsspppfynf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fftB (B:)
    mrlrkynkslgwlslfagtvllsgcnsalldpkgqigleqrsliltafglmlivvipail
    mavgfawkyrasnkdakyspnwshsnkveavvwtvpiliiiflavltwktthalepskpl
    ahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffiprlg
    sqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvakakq
    spntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfmahgksmdmtqpegehsah
    egmegmdmshaesah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fftB (B:)
    salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
    kveavvwtvpiliiiflavltwktthalepskplahdekpitievvsmdwkwffiypeqg
    iatvneiafpantpvyfkvtsnsvmnsffiprlgsqiyamagmqtrlhlianepgtydgi
    sasysgpgfsgmkfkaiatpdraafdqwvakakqspntmsdmaafeklaapseynqveyf
    snvkpdlfadvinkfma
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fftC (C:)
    matdtlthatahahehghhdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptg
    kdifelpfvlvetflllfssitygmaaiamyknnksqviswlaltwlfgagfigmeiyef
    hhlivngmgpdrsgflsaffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimcl
    slfwhfldvvwicvftvvylmgam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fftC (C:)
    hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf
    ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa
    ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv
    ylmga
    

  • Chain 'D':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fftF (F:)
    mfgklsldavpfhepivmvtiagiilgglalvglityfgkwtylwkewltsvdhkrlgim
    yiivaivmllrgfadaimmrsqqalasageagflpphhydqiftahgvimiffvampfvi
    glmnlvvplqigardvafpflnnlsfwftvvgvilvnvslgvgefaqtgwlaypplsgie
    yspgvgvdywiwslqlsgigttltginffvtilkmrapgmtmfkmpvftwaslcanvlii
    asfpiltvtvalltldrylgthfftndmggnmmmyinliwawghpevyililpvfgvfse
    iaatfsrkrlfgytslvwatvcitvlsfivwlhhfftmgaganvnaffgittmiiaiptg
    vkifnwlftmyqgrivfhsamlwtigfivtfsvggmtgvllavpgadfvlhnslfliahf
    hnviiggvvfgcfagmtywwpkafgfklnetwgkrafwfwiigffvafmplyalgfmgmt
    rrlsqqidpqfhtmlmiaasgavlialgilclviqmyvsirdrdqnrdltgdpwggrtle
    watsspppfynfavvphvherdafwemkekgeaykkpdhyeeihmpknsgagiviaafst
    ifgfamiwhiwwlaivgfagmiitwivksfdedvdyyvpvaeieklenqhfdeitkaglk
    ngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fftF (F:)
    vdhkrlgimyiivaivmllrgfadaimmrsqqalasageagflpphhydqiftahgvimi
    ffvampfviglmnlvvplqigardvafpflnnlsfwftvvgvilvnvslgvgefaqtgwl
    aypplsgieyspgvgvdywiwslqlsgigttltginffvtilkmrapgmtmfkmpvftwa
    slcanvliiasfpiltvtvalltldrylgthfftndmggnmmmyinliwawghpevyili
    lpvfgvfseiaatfsrkrlfgytslvwatvcitvlsfivwlhhfftmgaganvnaffgit
    tmiiaiptgvkifnwlftmyqgrivfhsamlwtigfivtfsvggmtgvllavpgadfvlh
    nslfliahfhnviiggvvfgcfagmtywwpkafgfklnetwgkrafwfwiigffvafmpl
    yalgfmgmtrrlsqqidpqfhtmlmiaasgavlialgilclviqmyvsirdrdqnrdltg
    dpwggrtlewatsspppfynf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1fftG (G:)
    mrlrkynkslgwlslfagtvllsgcnsalldpkgqigleqrsliltafglmlivvipail
    mavgfawkyrasnkdakyspnwshsnkveavvwtvpiliiiflavltwktthalepskpl
    ahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffiprlg
    sqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvakakq
    spntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfmahgksmdmtqpegehsah
    egmegmdmshaesah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fftG (G:)
    salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
    kveavvwtvpiliiiflavltwktthalepskplahdekpitievvsmdwkwffiypeqg
    iatvneiafpantpvyfkvtsnsvmnsffiprlgsqiyamagmqtrlhlianepgtydgi
    sasysgpgfsgmkfkaiatpdraafdqwvakakqspntmsdmaafeklaapseynqveyf
    snvkpdlfadvinkfma
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1fftH (H:)
    matdtlthatahahehghhdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptg
    kdifelpfvlvetflllfssitygmaaiamyknnksqviswlaltwlfgagfigmeiyef
    hhlivngmgpdrsgflsaffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimcl
    slfwhfldvvwicvftvvylmgam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fftH (H:)
    hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf
    ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa
    ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv
    ylmga
    

  • Chain 'I':
    No sequence available.