PDB entry 1fft

View 1fft on RCSB PDB site
Description: the structure of ubiquinol oxidase from escherichia coli
Deposited on 2000-07-26, released 2000-10-18
The last revision prior to the SCOP 1.57 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fftA (A:)
    vdhkrlgimyiivaivmllrgfadaimmrsqqalasageagflpphhydqiftahgvimi
    ffvampfviglmnlvvplqigardvafpflnnlsfwftvvgvilvnvslgvgefaqtgwl
    aypplsgieyspgvgvdywiwslqlsgigttltginffvtilkmrapgmtmfkmpvftwa
    slcanvliiasfpiltvtvalltldrylgthfftndmggnmmmyinliwawghpevyili
    lpvfgvfseiaatfsrkrlfgytslvwatvcitvlsfivwlhhfftmgaganvnaffgit
    tmiiaiptgvkifnwlftmyqgrivfhsamlwtigfivtfsvggmtgvllavpgadfvlh
    nslfliahfhnviiggvvfgcfagmtywwpkafgfklnetwgkrafwfwiigffvafmpl
    yalgfmgmtrrlsqqidpqfhtmlmiaasgavlialgilclviqmyvsirdrdqnrdltg
    dpwggrtlewatsspppfynf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fftB (B:)
    salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
    kveavvwtvpiliiiflavltwktthalepskplahdekpitievvsmdwkwffiypeqg
    iatvneiafpantpvyfkvtsnsvmnsffiprlgsqiyamagmqtrlhlianepgtydgi
    sasysgpgfsgmkfkaiatpdraafdqwvakakqspntmsdmaafeklaapseynqveyf
    snvkpdlfadvinkfma
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fftC (C:)
    hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf
    ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa
    ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv
    ylmga
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fftF (F:)
    vdhkrlgimyiivaivmllrgfadaimmrsqqalasageagflpphhydqiftahgvimi
    ffvampfviglmnlvvplqigardvafpflnnlsfwftvvgvilvnvslgvgefaqtgwl
    aypplsgieyspgvgvdywiwslqlsgigttltginffvtilkmrapgmtmfkmpvftwa
    slcanvliiasfpiltvtvalltldrylgthfftndmggnmmmyinliwawghpevyili
    lpvfgvfseiaatfsrkrlfgytslvwatvcitvlsfivwlhhfftmgaganvnaffgit
    tmiiaiptgvkifnwlftmyqgrivfhsamlwtigfivtfsvggmtgvllavpgadfvlh
    nslfliahfhnviiggvvfgcfagmtywwpkafgfklnetwgkrafwfwiigffvafmpl
    yalgfmgmtrrlsqqidpqfhtmlmiaasgavlialgilclviqmyvsirdrdqnrdltg
    dpwggrtlewatsspppfynf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fftG (G:)
    salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
    kveavvwtvpiliiiflavltwktthalepskplahdekpitievvsmdwkwffiypeqg
    iatvneiafpantpvyfkvtsnsvmnsffiprlgsqiyamagmqtrlhlianepgtydgi
    sasysgpgfsgmkfkaiatpdraafdqwvakakqspntmsdmaafeklaapseynqveyf
    snvkpdlfadvinkfma
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fftH (H:)
    hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf
    ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa
    ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv
    ylmga