PDB entry 1ffp

View 1ffp on RCSB PDB site
Description:
Deposited on 2000-07-25, released 2002-12-11
The last revision prior to the SCOP 1.69 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.25
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ffpa1, d1ffpa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ffpb_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ffpd1, d1ffpd2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ffpe_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffpA (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffpB (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffpD (D:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffpE (E:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm