PDB entry 1ffi

View 1ffi on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes
Deposited on 2000-07-25, released 2001-06-01
The last revision prior to the SCOP 1.71 freeze date was dated 2001-06-01, with a file datestamp of 2001-06-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.211
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.71: d1ffic_
  • Chain 'D':
    Domains in SCOP 1.71: d1ffid_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ffiC (C:)
pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ffiD (D:)
pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf