PDB entry 1ffc

View 1ffc on RCSB PDB site
Description: contribution of cutinase serine 42 side chain to the stabilization of the oxyanion transition state
Deposited on 1995-10-07, released 1996-03-08
The last revision prior to the SCOP 1.67 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.14
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1ffc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1ffc_ (-)
    lptsnpaqelearqlgrttrddlingnsascrdvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdlalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctg
    slivaaphlaygpdargpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffc_ (-)
    rttrddlingnsascrdvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdlalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs