PDB entry 1ffb

View 1ffb on RCSB PDB site
Description: contribution of cutinase serine 42 side chain to the stabilization of the oxyanion transition state
Class: hydrolase (serine esterase)
Keywords: hydrolase (serine esterase)
Deposited on 1995-10-07, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.147
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590
      • engineered (83)
    Domains in SCOPe 2.07: d1ffba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ffbA (A:)
    lptsnpaqelearqlgrttrddlingnsascrdvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgddalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctg
    slivaaphlaygpdargpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffbA (A:)
    rttrddlingnsascrdvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgddalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs