PDB entry 1ff0

View 1ff0 on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes.
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, mutant, dimer, inhibitor
Deposited on 2000-07-24, released 2001-06-01
The last revision prior to the SCOP 1.73 freeze date was dated 2001-06-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.201
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptide inhibitor (ace)ti(nle)(nle)qr
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587
    • engineered (6)
    • engineered (32)
    • engineered (44)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOP 1.73: d1ff0c_
• Chain 'D':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (44)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOP 1.73: d1ff0d_
• Heterogens: ACE, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ff0C (C:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpimiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ff0D (D:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpimiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf