PDB entry 1fd6

View 1fd6 on RCSB PDB site
Description: delta0: a computationally designed core variant of the b1 domain of streptococcal protein g
Class: protein binding
Keywords: Streptococcal Protein G, Protein Design, Backbone Design, Core Sidechain Packing
Deposited on 2000-07-19, released 2001-09-19
The last revision prior to the SCOP 1.73 freeze date was dated 2001-09-19, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (1-56)
      • initiating methionine (0)
      • engineered (1)
      • engineered (3)
      • engineered (7)
      • engineered (39)
    Domains in SCOP 1.73: d1fd6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fd6A (A:)
    mttfkliingktlkgettteavdaataekvfkqyandngidgewtyddatktftvte