PDB entry 1fd0

View 1fd0 on RCSB PDB site
Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the rargamma-selective retinoid sr11254
Deposited on 2000-07-19, released 2002-09-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-27, with a file datestamp of 2002-09-27.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.131
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1fd0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fd0A (A:)
    spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
    efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
    gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
    lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle