PDB entry 1fcz

View 1fcz on RCSB PDB site
Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the panagonist retinoid bms181156
Deposited on 2000-07-19, released 2000-09-11
The last revision prior to the SCOP 1.63 freeze date was dated 2001-09-11, with a file datestamp of 2001-09-11.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.132
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1fcza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fczA (A:)
    spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
    efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
    gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
    lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle