PDB entry 1fcx

View 1fcx on RCSB PDB site
Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the rargamma-selective retinoid bms184394
Deposited on 2000-07-19, released 2000-09-11
The last revision prior to the SCOP 1.61 freeze date was dated 2000-09-11, with a file datestamp of 2000-09-11.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.124
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1fcxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fcxA (A:)
spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle