PDB entry 1fcn

View 1fcn on RCSB PDB site
Description: crystal structure of the e. coli ampc beta-lactamase mutant q120l/y150e covalently acylated with the substrate beta-lactam loracarbef
Class: hydrolase
Keywords: beta-lactamase beta-lactam complex, enzyme inhibitor complex
Deposited on 2000-07-18, released 2000-12-04
The last revision prior to the SCOP 1.75 freeze date was dated 2000-12-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered (116)
      • engineered (146)
    Domains in SCOP 1.75: d1fcna_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered (116)
      • engineered (146)
    Domains in SCOP 1.75: d1fcnb_
  • Heterogens: LOR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fcnA (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglpllvpd
    evksssdllrfyqnwqpawapgtqrleanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fcnA (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglpllvpd
    evksssdllrfyqnwqpawapgtqrleanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiiialaarpvkaitpptpavr
    aswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcnB (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglpllvpd
    evksssdllrfyqnwqpawapgtqrleanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq