PDB entry 1fcl

View 1fcl on RCSB PDB site
Description: delta1.5: a computationally designed core variant of the b1 domain of streptococcal protein g
Class: protein binding
Keywords: Designed Core Mutant, Streptococcal Protein G
Deposited on 2000-07-18, released 2001-09-19
The last revision prior to the SCOP 1.73 freeze date was dated 2001-09-19, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (0-55)
      • engineered (0)
      • engineered (2)
      • engineered (6)
      • engineered (29)
      • engineered (33)
      • engineered (38)
      • engineered (51)
    Domains in SCOP 1.73: d1fcla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fclA (A:)
    ttfkliingktlkgettteavdaataekvlkqyindngidgewtyddatktwtvte