PDB entry 1fcg

View 1fcg on RCSB PDB site
Description: ectodomain of human fc gamma receptor, fcgriia
Deposited on 1999-04-07, released 2000-04-12
The last revision prior to the SCOP 1.57 freeze date was dated 2000-04-12, with a file datestamp of 2000-04-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcgA (A:)
    appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
    ndsgeytcqtgqtslsdpvhltvlfewlvlqtphlefqegetimlrchswkdkplvkvtf
    fqngksqkfshldptfsipqanhshsgdyhctgnigytlfsskpvtitvqv