PDB entry 1fcf

View 1fcf on RCSB PDB site
Description: photosystem ii d1 c-terminal processing protease
Deposited on 2000-07-18, released 2001-01-18
The last revision prior to the SCOP 1.57 freeze date was dated 2001-01-18, with a file datestamp of 2001-01-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcfA (A:)
    mvtseqllfleawravdrayvdksfngqswfklretylkkepmdrraqtydairkllavl
    ddpftrflepsrlaalrrgtagsvtgvgleitydggsgkdvvvltpapggpaekagarag
    dvivtvdgtavkglslydvsdllqgeadsqvevvlhapgapsntrtlqltrqkvtinpvt
    fttcsnvaaaalppgaakqqlgyvrlatfnsnttaaaqqaftelskqgvaglvldirnng
    gglfpagvnvarmlvdrgdlvliadsqgirdiysadgnsidsatplvvlvnrgtasasev
    lagalkdskrgliagertfgkgliqtvvdlsdgsgvavtvaryqtpagvdinkigvspdv
    qldpevlptdlegvcrvlgsdaaprlf