PDB entry 1fc7

View 1fc7 on RCSB PDB site
Description: photosystem ii d1 c-terminal processing protease
Deposited on 2000-07-18, released 2001-01-18
The last revision prior to the SCOP 1.59 freeze date was dated 2001-01-18, with a file datestamp of 2001-01-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fc7A (A:)
    vtseqllfleawravdrayvdksfngqswfklretylkkepmdrraqtydairkllavld
    dpftrflepsrlaalrrgtagsvtgvgleitydggsgkdvvvltpapggpaekagaragd
    vivtvdgtavkglslydvsdllqgeadsqvevvlhapgapsntrtlqltrqkvtinpvtf
    ttcsnvaaaalppgaakqqlgyvrlatfnsnttaaaqqaftelskqgvaglvldirnngg
    glfpagvnvarmlvdrgdlvliadsqgirdiysadgnsidsatplvvlvnrgtasasevl
    agalkdskrgliagertfgkgliqtvvdlsdgsgvavtvaryqtpagvdinkigvspdvq
    ldpevlptdlegvcrvlgsdaaprlf