PDB entry 1fc2

View 1fc2 on RCSB PDB site
Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1981-05-21, released 1981-10-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: immunoglobulin fc
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fc2c_
  • Chain 'D':
    Compound: fragment b of protein a complex
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA75032
      • conflict (49)
      • conflict (60)
      • conflict (71)
      • conflict (89)
      • conflict (92)
    Domains in SCOP 1.73: d1fc2d1, d1fc2d2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fc2C (C:)
    adnkfnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqxxk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc2C (C:)
    fnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fc2D (D:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgv
    qvhnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq
    prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc2D (D:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls