PDB entry 1fc2

View 1fc2 on RCSB PDB site
Description: Crystallographic Refinement and Atomic Models of a Human FC Fragment and its Complex with Fragment B of Protein A from Staphylococcus Aureus at 2.9-and 2.8-Angstroms Resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1981-05-21, released 1981-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: fragment b of protein a complex
    Species: Staphylococcus aureus subsp. aureus [TaxId:93061]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fc2c_
  • Chain 'D':
    Compound: immunoglobulin fc
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA75032
      • conflict (49)
      • conflict (60)
      • conflict (71)
      • conflict (89)
      • conflict (92)
    Domains in SCOPe 2.07: d1fc2d1, d1fc2d2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fc2C (C:)
    adnkfnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqxxk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc2C (C:)
    fnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fc2D (D:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgv
    qvhnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq
    prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc2D (D:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls