PDB entry 1fc1

View 1fc1 on RCSB PDB site
Description:
Deposited on 1981-05-21, released 1981-10-02
The last revision prior to the SCOP 1.55 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fc1a1, d1fc1a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fc1b1, d1fc1b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fc1A (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fc1B (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls