PDB entry 1fbz

View 1fbz on RCSB PDB site
Description: Structure-based design of a novel, osteoclast-selective, nonpeptide Src SH2 inhibitor with in vivo anti-resorptive activity
Deposited on 2000-07-17, released 2000-08-23
The last revision prior to the SCOP 1.57 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1fbza_
  • Chain 'B':
    Domains in SCOP 1.57: d1fbzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbzA (A:)
    epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
    irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbzB (B:)
    epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
    irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt