PDB entry 1fby

View 1fby on RCSB PDB site
Description: crystal structure of the human rxr alpha ligand binding domain bound to 9-cis retinoic acid
Deposited on 2000-07-17, released 2000-07-28
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-24, with a file datestamp of 2000-08-24.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fbya_
  • Chain 'B':
    Domains in SCOP 1.55: d1fbyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fbyA (A:)
    ssanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewa
    kriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvg
    aifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleay
    ckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fbyA (A:)
    ssanedmpverileaelavepdpvtnicqaadkqlftlvewakriphfselplddqvill
    ragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmq
    mdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllr
    lpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fbyB (B:)
    dmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriph
    fselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdr
    vltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhky
    peqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fbyB (B:)
    dmpverileaelavepdpvtnicqaadkqlftlvewakriphfselplddqvillragwn
    elliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdkte
    lgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalr
    siglkclehlfffkligdtpidtflmemleap