PDB entry 1fbn

View 1fbn on RCSB PDB site
Description: crystal structure of a fibrillarin homologue from methanococcus jannaschii, a hyperthermophile, at 1.6 a
Class: ribosome
Keywords: FIBRILLARIN, MJ PROTEINS, RIBOSOMAL RNA PROCESSING, SNORNP, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, RIBOSOME
Deposited on 1999-04-25, released 2000-04-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.229
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mj fibrillarin homologue
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58108 (0-229)
      • modified residue (0)
      • modified residue (69)
      • modified residue (110)
      • modified residue (174)
      • modified residue (221)
    Domains in SCOPe 2.04: d1fbna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbnA (A:)
    medikikeifeniyevdlgdglkriatksivkgkkvydekiikigdeeyriwnpnkskla
    aaiikglkvmpikrdskilylgasagttpshvadiadkgivyaieyaprimrelldacae
    reniipilgdankpqeyanivekvdviyedvaqpnqaeiliknakwflkkggygmiaika
    rsidvtkdpkeifkeqkeileaggfkivdevdiepfekdhvmfvgiwegk