PDB entry 1fbn

View 1fbn on RCSB PDB site
Description: crystal structure of a fibrillarin homologue from methanococcus jannaschii, a hyperthermophile, at 1.6 a
Deposited on 1999-04-25, released 2000-04-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.229
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fbna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fbnA (A:)
medikikeifeniyevdlgdglkriatksivkgkkvydekiikigdeeyriwnpnkskla
aaiikglkvmpikrdskilylgasagttpshvadiadkgivyaieyaprimrelldacae
reniipilgdankpqeyanivekvdviyedvaqpnqaeiliknakwflkkggygmiaika
rsidvtkdpkeifkeqkeileaggfkivdevdiepfekdhvmfvgiwegk