PDB entry 1fbk

View 1fbk on RCSB PDB site
Description: crystal structure of cytoplasmically open conformation of bacteriorhodopsin
Deposited on 2000-07-15, released 2000-08-09
The last revision prior to the SCOP 1.61 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: EDIF
Resolution: 3.2 Å
R-factor: 0.272
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1fbka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbkA (A:)
    itgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllg
    ygltmvpfggeqnpiywaryadwlfttpllllglallvdadqgtilalvgadgimigtgl
    vgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastckvlrnvtvvlws
    aypvvwligsegagivplnietllfmvldvsakvglglillrsra