PDB entry 1fb7

View 1fb7 on RCSB PDB site
Description: crystal structure of an in vivo hiv-1 protease mutant in complex with saquinavir: insights into the mechanisms of drug resistance
Class: hydrolase/hydrolase inhibitor
Keywords: HIV protease, mutant, drug resistance, Viral protein, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-07-14, released 2000-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.187
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q72874 (0-98)
    • engineered (47)
    • engineered (89)
  Domains in SCOPe 2.06: d1fb7a_
• Heterogens: ROC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fb7A (A:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmivgiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlmtqigctlnf