PDB entry 1fb7

View 1fb7 on RCSB PDB site
Description: crystal structure of an in vivo hiv-1 protease mutant in complex with saquinavir: insights into the mechanisms of drug resistance
Deposited on 2000-07-14, released 2000-12-13
The last revision prior to the SCOP 1.71 freeze date was dated 2000-12-13, with a file datestamp of 2000-12-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.187
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1fb7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb7A (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmivgiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlmtqigctlnf