PDB entry 1fb6

View 1fb6 on RCSB PDB site
Description: crystal structure of thioredoxin m from spinach chloroplast (oxidized form)
Deposited on 2000-07-14, released 2000-09-20
The last revision prior to the SCOP 1.67 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1fb6a_
  • Chain 'B':
    Domains in SCOP 1.67: d1fb6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fb6A (A:)
    evqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntde
    apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fb6A (A:)
    vqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntdea
    pgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fb6B (B:)
    evqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntde
    apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fb6B (B:)
    vqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntdea
    pgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl