PDB entry 1fb3

View 1fb3 on RCSB PDB site
Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika
Deposited on 2000-07-14, released 2000-08-02
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.265
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb3A (A:)
    iskkqdegvvvnkfrpkepyigrcllntkitgddapgetwhmvfstegeipyregqsigv
    iadgvdangkphklrlysiassalgdfgdsktvslcvkrlvytndkgeevkgvcsnflcd
    lkpgadvkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhddykfngla
    wlflgvptsssllykeefekmkekapenfrldfavsreqtnekgekmyiqtrmaqyaeel
    wtllkkdntfvymcglkgmeqgiddimsslaakegidwadykkqlkkaeqwnvevy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb3B (B:)
    iskkqdegvvvnkfrpkepyigrcllntkitgddapgetwhmvfstegeipyregqsigv
    iadgvdangkphklrlysiassalgdfgdsktvslcvkrlvytndkgeevkgvcsnflcd
    lkpgadvkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhddykfngla
    wlflgvptsssllykeefekmkekapenfrldfavsreqtnekgekmyiqtrmaqyaeel
    wtllkkdntfvymcglkgmeqgiddimsslaakegidwadykkqlkkaeqwnvevy