PDB entry 1fb2

View 1fb2 on RCSB PDB site
Description: structure of phospholipase a2 from daboia russelli pulchella at 1.95
Class: toxin
Keywords: Phospholipase A2, Daboia Russelli Pulchella, Neurotoxic, TOXIN
Deposited on 2000-07-14, released 2001-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fb2a_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fb2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb2A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb2B (B:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c