PDB entry 1fb0

View 1fb0 on RCSB PDB site
Description: crystal structure of thioredoxin m from spinach chloroplast (reduced form)
Class: electron transport
Keywords: electron transport
Deposited on 2000-07-14, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin m
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fb0a_
  • Chain 'B':
    Compound: thioredoxin m
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fb0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb0A (A:)
    evqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntde
    apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fb0B (B:)
    evqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntde
    apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fb0B (B:)
    vqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntdea
    pgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl