PDB entry 1fap

View 1fap on RCSB PDB site
Description: the structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Class: complex (isomerase/kinase)
Keywords: fkbp12, frap, rapamycin, complex (isomerase/kinase)
Deposited on 1996-03-15, released 1997-07-23
The last revision prior to the SCOP 1.73 freeze date was dated 1997-07-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.193
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506-binding protein
    Species: HOMO SAPIENS
    Gene: HUMAN HIPPOCAMPAL CDNA LIBRARY
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fapa_
  • Chain 'B':
    Compound: frap
    Species: HOMO SAPIENS
    Gene: HUMAN HIPPOCAMPAL CDNA LIBRARY
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fapb_
  • Heterogens: RAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fapA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fapB (B:)
    rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd
    lmeaqewcrkymksgnvkdltqawdlyyhvfrris