PDB entry 1faf

View 1faf on RCSB PDB site
Description: nmr structure of the n-terminal j domain of murine polyomavirus t antigens.
Deposited on 2000-07-13, released 2000-11-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: NMR47
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1fafa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fafA (A:)
  mdrvlsradkerllellklprqlwgdfgrmqqaykqqslllhpdkggshalmqelnslwg
  tfktevynlrmnlggtgfq