PDB entry 1faf

View 1faf on RCSB PDB site
Description: nmr structure of the n-terminal j domain of murine polyomavirus t antigens.
Class: Viral protein
Keywords: J DOMAIN, HPD MOTIF, ANTI-PARALLEL HAIRPIN OF HELICES, Viral protein
Deposited on 2000-07-13, released 2000-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: Murine polyomavirus [TaxId:10634]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fafa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fafA (A:)
    mdrvlsradkerllellklprqlwgdfgrmqqaykqqslllhpdkggshalmqelnslwg
    tfktevynlrmnlggtgfq