PDB entry 1faa

View 1faa on RCSB PDB site
Description: crystal structure of thioredoxin f from spinach chloroplast (long form)
Deposited on 2000-07-13, released 2000-09-20
The last revision prior to the SCOP 1.67 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1faaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1faaA (A:)
    myylelalgtqemeaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkye
    klaeeyldviflkldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiq
    aars
    

    Sequence, based on observed residues (ATOM records): (download)
    >1faaA (A:)
    lelalgtqemeaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyekla
    eeyldviflkldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaar
    s