PDB entry 1faa

View 1faa on RCSB PDB site
Description: crystal structure of thioredoxin f from spinach chloroplast (long form)
Class: electron transport
Keywords: electron transport
Deposited on 2000-07-13, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin f
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09856 (3-123)
      • engineered (3)
      • engineered (5)
    Domains in SCOPe 2.07: d1faaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1faaA (A:)
    myylelalgtqemeaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkye
    klaeeyldviflkldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiq
    aars
    

    Sequence, based on observed residues (ATOM records): (download)
    >1faaA (A:)
    lelalgtqemeaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyekla
    eeyldviflkldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaar
    s