PDB entry 1fa2

View 1fa2 on RCSB PDB site
Description: crystal structure of beta-amylase from sweet potato
Deposited on 2000-07-12, released 2000-08-16
The last revision prior to the SCOP 1.57 freeze date was dated 2000-08-16, with a file datestamp of 2000-08-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1fa2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fa2A (A:)
    apipgvmpignyvslyvmlplgvvnadnvfpdkekvedelkqvkaggcdgvmvdvwwgii
    eakgpkqydwsayrelfqlvkkcglkiqaimsfhqcggnvgdavfipipqwilqigdknp
    difytnragnrnqeylslgvdnqrlfqgrtalemyrdfmesfrdnmadflkagdivdiev
    gcgaagelrypsypetqgwvfpgigefqcydkymvadwkeavkqagnadwempgkgagty
    ndtpdkteffrpngtyktdmgkffltwysnkliihgdqvleeankvfvglrvniaakvsg
    ihwwynhvshaaeltagfynvagrdgyrpiarmlarhhatlnftclemrdseqpaeaksa
    pqelvqqvlssgwkeyidvagenalprydataynqmllklrpngvnlngppklkmsglty
    lrlsddllqtdnfelfkkfvkkmhadldpspnaispavlersnsaitidelmeatkgsrp
    fpwydvtdmpvdgsnpfd