PDB entry 1fa0

View 1fa0 on RCSB PDB site
Description: structure of yeast poly(a) polymerase bound to manganate and 3'-datp
Deposited on 2000-07-11, released 2000-08-30
The last revision prior to the SCOP 1.61 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fa0A (A:)
    sqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrf
    vyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfds
    llrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnlde
    kdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlvar
    icqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpv
    itpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykfyl
    eitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccpteddye
    miqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfnienkkekvdih
    ipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fa0A (A:)
    sqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrf
    vyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfds
    llrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnlde
    kdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlvar
    icqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpv
    itpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykfyl
    eitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccpteddye
    miqdklklvtdenkeeesikdapkaylstmyigldfnienkkekvdihipctefvnlcrs
    fnedygdhkvfnlalrfvkgydlpdevfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fa0B (B:)
    ssqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqr
    fvyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfd
    sllrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnld
    ekdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlva
    ricqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmp
    vitpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykfy
    leitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccpteddy
    emiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfnienkkekvdi
    hipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fa0B (B:)
    ssqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqr
    fvyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfd
    sllrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnld
    ekdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlva
    ricqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmp
    vitpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykfy
    leitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccpteddy
    emiqdkygshktetalnalklvtpkaylstmyigldfnkvdihipctefvnlcrsfnedy
    gdhkvfnlalrfvkgydlpdevfdenekrps