PDB entry 1f9m

View 1f9m on RCSB PDB site
Description: crystal structure of thioredoxin f from spinach chloroplast (short form)
Deposited on 2000-07-11, released 2000-09-20
The last revision prior to the SCOP 1.67 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1f9ma_
  • Chain 'B':
    Domains in SCOP 1.67: d1f9mb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f9mA (A:)
meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f9mB (B:)
meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars