PDB entry 1f99

View 1f99 on RCSB PDB site
Description: crystal structure of r-phycocyanin from polysiphonia at 2.4 a resolution
Class: photosynthesis
Keywords: LIGHT HARVESTING PROTEIN, R-PHYCOCYANIN, photosynthesis, electron trasnport
Deposited on 2000-07-09, released 2001-07-09
The last revision prior to the SCOP 1.75 freeze date was dated 2001-08-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: r-phycocyanin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f99a_
  • Chain 'B':
    Compound: r-phycocyanin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f99b_
  • Chain 'K':
    Compound: r-phycocyanin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f99k_
  • Chain 'L':
    Compound: r-phycocyanin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f99l_
  • Chain 'M':
    Compound: r-phycocyanin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f99m_
  • Chain 'N':
    Compound: r-phycocyanin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f99n_
  • Heterogens: BLA, CYC, PEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f99A (A:)
    mktplteaiaaadsqgrflsntelqvvngrynratssleaakaltanadrlisgaanavy
    skfpyttqmpgpnysstaigkakcardigyylrmvtyclvvggtgpmddylvagleeinr
    tfelspswyiealkyiknnhglsgdvaneantyidyaintls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f99B (B:)
    mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf
    aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal
    gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f99K (K:)
    mktplteaiaaadsqgrflsntelqvvngrynratssleaakaltanadrlisgaanavy
    skfpyttqmpgpnysstaigkakcardigyylrmvtyclvvggtgpmddylvagleeinr
    tfelspswyiealkyiknnhglsgdvaneantyidyaintls
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f99L (L:)
    mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf
    aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal
    gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f99M (M:)
    mktplteaiaaadsqgrflsntelqvvngrynratssleaakaltanadrlisgaanavy
    skfpyttqmpgpnysstaigkakcardigyylrmvtyclvvggtgpmddylvagleeinr
    tfelspswyiealkyiknnhglsgdvaneantyidyaintls
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f99N (N:)
    mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf
    aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal
    gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava