PDB entry 1f90

View 1f90 on RCSB PDB site
Description: fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide
Deposited on 2000-07-06, released 2001-07-11
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-10, with a file datestamp of 2001-10-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.165
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f90H (H:)
    gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
    npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsaak
    ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f90L (L:)
    dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec