PDB entry 1f88

View 1f88 on RCSB PDB site
Description: crystal structure of bovine rhodopsin
Deposited on 2000-06-29, released 2000-08-04
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-04, with a file datestamp of 2000-08-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.186
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1f88a_
  • Chain 'B':
    Domains in SCOP 1.59: d1f88b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f88A (A:)
    mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
    vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
    geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
    egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
    attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
    ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f88A (A:)
    mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
    vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
    geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
    egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaasattq
    kaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsavynpv
    iyimmnkqfrncmvttlccgknpsttvsktetsqvapa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f88B (B:)
    mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
    vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
    geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
    egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
    attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
    ynpviyimmnkqfrncmvttlccgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f88B (B:)
    mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
    vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
    geialwslvvlaieryvvvckpfgenhaimgvaftwvmalacaapplvgwsryipegmqc
    scgidyytpheetnnesfviymfvvhfiipliviffcygqltqkaekevtrmviimviaf
    licwlpyagvafyifthqgsdfgpifmtipaffaktsavynpviyimmnkqfrncmvttl
    ccgkn