PDB entry 1f86
View 1f86 on RCSB PDB site
Description: transthyretin thr119met protein stabilisation
Class: transport protein
Keywords: transthyretin, protein stability, X-ray crystal structure, amyloidogenesis, TRANSPORT PROTEIN
Deposited on
2000-06-29, released
2001-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.14
AEROSPACI score: 0.92
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: transthyretin thr119met variant
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1f86a_ - Chain 'B':
Compound: transthyretin thr119met variant
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1f86b_ - Heterogens: T44, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1f86A (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1f86B (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn