PDB entry 1f7y

View 1f7y on RCSB PDB site
Description: the crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability
Class: ribosome
Keywords: uucg, tetraloop, RNA, ribosome
Deposited on 2000-06-28, released 2000-11-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80378
      • engineered (11)
      • engineered (57-58)
      • engineered (79)
    Domains in SCOPe 2.03: d1f7ya_
  • Chain 'B':
    Compound: 16s ribosomal RNA fragment
    Species: synthetic, synthetic
  • Heterogens: MG, NA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f7yA (A:)
    mpitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyrmlieklgirg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f7yA (A:)
    pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyrmlieklgi
    

  • Chain 'B':
    No sequence available.