PDB entry 1f7y
View 1f7y on RCSB PDB site
Description: the crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability
Class: ribosome
Keywords: uucg, tetraloop, RNA, x-ray, ribosome
Deposited on
2000-06-28, released
2000-11-22
The last revision prior to the SCOP 1.75 freeze date was dated
2000-11-22, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 30S ribosomal protein S15
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Uniprot P80378
- engineered (11)
- engineered (57-58)
- engineered (79)
Domains in SCOP 1.75: d1f7ya_ - Chain 'B':
Compound: 16s ribosomal RNA fragment
Species: synthetic, synthetic
- Heterogens: MG, NA, K, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1f7yA (A:)
mpitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
gqrrrllrylqredperyrmlieklgirg
Sequence, based on observed residues (ATOM records): (download)
>1f7yA (A:)
pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyrmlieklgi
- Chain 'B':
No sequence available.