PDB entry 1f7y

View 1f7y on RCSB PDB site
Description: the crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability
Deposited on 2000-06-28, released 2000-11-22
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1f7ya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f7yA (A:)
  pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
  qrrrllrylqredperyrmlieklgi