PDB entry 1f7e

View 1f7e on RCSB PDB site
Description: the first egf-like domain from human blood coagulation fvii, nmr, 20 structures
Deposited on 1999-02-19, released 1999-06-16
The last revision prior to the SCOP 1.71 freeze date was dated 1999-06-16, with a file datestamp of 1999-06-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1f7ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f7eA (A:)
    sdgdqcasspcqnggsckdqlqsyicfclpafegrncethkddgsa