PDB entry 1f77

View 1f77 on RCSB PDB site
Description: staphylococcal enterotoxin h determined to 2.4 a resolution
Deposited on 2000-06-26, released 2000-07-19
The last revision prior to the SCOP 1.59 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f77A (A:)
    dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
    laqkfknknvdiygasfyykcekiseniseclyggttlnseklaqerviganvwvdgiqk
    etelirtnkknvtlqeldikirkilsdkykiyykdseiskgliefdmktprdysfdiydl
    kgendyeidkiyednktlksddishidvnlytk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f77A (A:)
    dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
    laqkfknknvdiygasfyykcekisniseclyggttlnseklaqerviganvwvdgiqke
    telirtnkknvtlqeldikirkilsdkykiyykdseiskgliefdmktprdysfdiydlk
    gendyeidkiyednktlksddishidvnlytk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f77B (B:)
    dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
    laqkfknknvdiygasfyykcekiseniseclyggttlnseklaqerviganvwvdgiqk
    etelirtnkknvtlqeldikirkilsdkykiyykdseiskgliefdmktprdysfdiydl
    kgendyeidkiyednktlksddishidvnlyt