PDB entry 1f71

View 1f71 on RCSB PDB site
Description: refined solution structure of calmodulin c-terminal domain
Class: transport protein
Keywords: Calcium binding, EF hand, four-helix bundle
Deposited on 2000-06-24, released 2000-09-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Xenopus laevis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62155 (0-66)
  Domains in SCOP 1.75: d1f71a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f71A (A:)
  eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
  vqmmtak