PDB entry 1f70

View 1f70 on RCSB PDB site
Description: refined solution structure of calmodulin n-terminal domain
Class: transport protein
Keywords: Calcium binding, EF hands, four-helix bundle
Deposited on 2000-06-24, released 2000-09-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-06.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Xenopus laevis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62155 (1-End)
  Domains in SCOP 1.75: d1f70a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f70A (A:)
  adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
  gtidfpefltmmarkm