PDB entry 1f70

View 1f70 on RCSB PDB site
Description: refined solution structure of calmodulin n-terminal domain
Class: transport protein
Keywords: Calcium binding, EF hands, four-helix bundle, TRANSPORT PROTEIN
Deposited on 2000-06-24, released 2000-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62155 (1-75)
  Domains in SCOPe 2.08: d1f70a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f70A (A:)
  adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
  gtidfpefltmmarkm